SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150193|ref|YP_007780369.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150193|ref|YP_007780369.1|
Domain Number 1 Region: 554-618
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000157
Family Type I dockerin domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|479150193|ref|YP_007780369.1|
Domain Number - Region: 348-421
Classification Level Classification E-value
Superfamily PA1994-like 0.0654
Family PA1994-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150193|ref|YP_007780369.1|
Sequence length 630
Comment hypothetical protein RBR_01410 [Ruminococcus bromii L2-63]
Sequence
MKKSSKVLSLVLAVLMAVSCFSGLTIFSASAEETDTKIYFDASNLPAEWGTTKTVYCHLY
AVAGDDLPETSWQGKAEKCKKDTATGLYYFDTAKLKSADGTNHGGLKDNADYAVIFSTID
TKSQSHQTCNVTLGKPCLGDTIYLTGGTVENTEDSSKRDFAATWKNNSDNYGPKAAITSL
GHVTEGRFPIYLSRAEMVAQAIFNWAVKNPKNYTPETVADICAQVEAEPMDVYNAYAEMY
ATELADPAAYPDCAPLTTVATLLGVDPSGTTAPATEEPTTVEPTTVEPTTVEPTTVEPTT
EPTTEPATEPADATQYVVAGVESLTGYEWQGSPALAPENVMTKSGDVYTKTFTAVPVGKS
YQLKVVANTGDEQKWIGLDGTDNNVTFDVESACDVTVTFNPATNEIAVTGDGVKMVTDLE
INSITVVGNGENSWLNGVAWGVDAEVNHMTQIADKVYQITYTGVESADAAYQFKFAVNDD
WAANWGLPEQSAATIGEDFDLTFNGENMLLNTVSAGYPEDSLVDVTITLDLTKFDYPSRS
GAKANIKIDGNRVPLLGDADGDYSITVVDATTIQKIAINLMSIAADDANAFKACDANEDG
RISIKDATIVQKYIVGGYETGNVGSPISVE
Download sequence
Identical sequences D4L4P7
gi|479150193|ref|YP_007780369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]