SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150227|ref|YP_007780403.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150227|ref|YP_007780403.1|
Domain Number 1 Region: 6-109
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.58e-37
Family N-utilization substance G protein NusG, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 117-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.16e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150227|ref|YP_007780403.1|
Sequence length 175
Comment transcription antitermination protein nusG [Ruminococcus bromii L2-63]
Sequence
MAESEARWYVVHTYSGYENKVATDLMTTAENRNLQDMIIDVKVPVEIVTETVGDKTKEVE
NKLFPGYVFVKMVYTDETWYVVRNIRGCTGFVGPGSKPVPLTDAEVYRMGVETRSVKLNY
SVGDSVRIIDGPLEDFVGVVEEIDADKDYVRVVVSMFGRETPVELELAQAEPIED
Download sequence
Identical sequences A0A1C6GLR9 A0A1Q6S820 D4L4T1 R5E5Z8
gi|479150227|ref|YP_007780403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]