SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150323|ref|YP_007780499.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150323|ref|YP_007780499.1|
Domain Number 1 Region: 398-469
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000932
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479150323|ref|YP_007780499.1|
Sequence length 471
Comment Dockerin type I repeat [Ruminococcus bromii L2-63]
Sequence
MKNKIKKNIHRTLSVFMIVLLMLGVVPIVGVNAAEKVSDFEYSVLDDGTVEITRYIDDGS
SDVIIPEVIEGKIVTSISDACFCEFTGPASGFENIESIFIPKTVNNLAEYDWEYDNTKNN
CWTFSKLPNLKEISVDEENEKYSSNDGVLFDKKKETLMYYPRAKQSTEYTVPNTVRYINN
CSFYQNVFLQKLKFSDKLNQVALDAIYNLKEVEYPILTIKPSDYEYVVRYCPNLKKVTIG
REVNFIPEYEFHDLKEYEKDVTLYVYDNSYALEWAKEHGFAYKIIEEPTVAEELIDTNTG
ITVKGTMNPDTTLDIEKVENTVDNSVATYDITLKNNGVLIQPESTITISIPSTEINCKVV
CLKDDGTVQDMNAEYNNGYYVFETDHLSKYAIIKTNIRLKGDVDNNGIINVVDATDIQKY
VVNLTDENGNKFIDVNNAEDVYVADVNGDGIINVVDATLIQKYIVRLVESL
Download sequence
Identical sequences D4L527
gi|479150323|ref|YP_007780499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]