SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150435|ref|YP_007780611.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150435|ref|YP_007780611.1|
Domain Number 1 Region: 487-546
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000458
Family Type I dockerin domain 0.0038
Further Details:      
 
Domain Number 2 Region: 245-331
Classification Level Classification E-value
Superfamily PKD domain 0.0000589
Family PKD domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|479150435|ref|YP_007780611.1|
Domain Number - Region: 340-415
Classification Level Classification E-value
Superfamily E set domains 0.0478
Family Copper resistance protein C (CopC, PcoC) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150435|ref|YP_007780611.1|
Sequence length 548
Comment hypothetical protein RBR_04310 [Ruminococcus bromii L2-63]
Sequence
MVKRQHKIMCLVLCLMLAVSTVFVGVVSASAATGDTVYVRVNNGWSNVNCYMWTDGVGSN
ASWPGKAMTKVEDGVYSYTLDKDYTSVIFNNGSKQTGDLTYPGHGKIYDLTNGTWSDYAG
APSQDATAQRPTSATTATTATTATTPSGEGTTVYLNNEAGWATPVAYMWNSNSDSNGSWP
GVKMTNIGGNVYQYTASKTYTSCIFSNSGQTQTGNLTAKDGYIYNNKTNQWSVYDTSPLQ
VKEFTADPASNIYTGTDVQLSATAANKSGAAVSYKFSVTNAQGGTSTLSDFSSAKSVTWT
PTVAGEYTITFDFKDTDGNTNNRTMTLEVKDDSALVKPIIKSVTPANLNLIKVNSTATVT
VKAGGGKTGTNLLFYKYVVTDPNGVQNTPYYTLNNIYTFVPTMKGEYKVNVYVQSSDNST
INKTYTYTAADDVTEPTTVVVPTTAPQPTTVQPTTVKPTTPQPTTVKPTTPQPTTVQPTT
APERLRGDVDGDGEVTVMDSTYLQKSIVGISGVPALETLDLKICDLDGDGTISVKDATII
QKIVVNLE
Download sequence
Identical sequences D4L5D9
gi|479150435|ref|YP_007780611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]