SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150437|ref|YP_007780613.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150437|ref|YP_007780613.1|
Domain Number 1 Region: 66-289
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.82e-25
Family Papain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 492-548
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000245
Family Type I dockerin domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|479150437|ref|YP_007780613.1|
Domain Number - Region: 263-341
Classification Level Classification E-value
Superfamily Thymidylate synthase/dCMP hydroxymethylase 0.0654
Family Thymidylate synthase/dCMP hydroxymethylase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150437|ref|YP_007780613.1|
Sequence length 550
Comment Cysteine protease [Ruminococcus bromii L2-63]
Sequence
MNKKFAEKFTAVVSAVCMISVGIASVNAAEIDDGFESVTKNAQSSDSSFPSAYSAIGYSL
VDENGLPSNFSSKNLGFVTPIKAQQYNDCWAVAGTEGFETKLLKLGYPVTEMSHDHANAS
STTQTNGKGWQRKYRDGGFTNIYPGYLTSWQGGAEIADVGKIDFSKNIHGDDMTADKTKY
GTTKLRYLDGVDSNEIKQAIIDNGSVTASYATSNKCFNNAGTTYFMPQSYDGDYVGHTIS
IVGWNDNLNRYRFSNGTGVLPQNNGAWLVRNSWGDNNTMGGYFWLSYEDKYIFGEKYSPN
FTIDEVTEITDDMTLLQDERYGATYSFNYVDSNDITFINCFDFGENSRTLDKVLFETKSN
GADYEIYYIPVRDGVPSNDESEWKSVASGKVAYSGYQSVDANGFVAPLGRGAVGVRIKTN
SEELSQLGVGEWLTSATKMTFLNDSSYGNSYIKYDGTTCELLDWYKTERDDALGGTFVIK
AVALKNDKILNGDVDLDGDIAVKDATLVQKYIVKLEQFDNTQLCNADCDGDGDITVADAT
KIQKIVVGIN
Download sequence
Identical sequences D4L5E1
gi|479150437|ref|YP_007780613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]