SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150479|ref|YP_007780655.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150479|ref|YP_007780655.1|
Domain Number 1 Region: 136-261
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000000229
Family Transglutaminase core 0.03
Further Details:      
 
Domain Number 2 Region: 451-509
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000343
Family Type I dockerin domain 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|479150479|ref|YP_007780655.1|
Domain Number - Region: 312-423
Classification Level Classification E-value
Superfamily YWTD domain 0.00602
Family YWTD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150479|ref|YP_007780655.1|
Sequence length 509
Comment Transglutaminase-like superfamily [Ruminococcus bromii L2-63]
Sequence
MKNIKKTAGKLFAMILTVSVAVSCVVSTGIFTASAYTAPKEGKIFYNKTMYDKYGKAEGM
VLDSLKNFDEEIDISSLNVPRSDVAEFFKVLTLTHPELYYVNQGFSYSYYPSEDTITSIH
PEYTISKSEYATQKKLLDKETERILSLVKEDMTDSEKALVIHDELAIMSEYSTSDYNKAD
IYNSLVEKTSVCQGYALAYSYMLSLVGIDSELVDSNSMNHMWNKVHIGNAWYNVDVTWDD
PINDRPGHAQHTYFLLSDNAIQNLPSKHYDYTISNSANSTKYDNYEIHNFDTRLCEINGE
FYGFVNNNSSANKGALLKYKLDSNTYEKKLKLNERWSAGGNSYWINTFMSLEKYNDTLYF
NTSDAVYSYDVGTGRQAVAASDISGVSVSSGKLCYGMVLKGDAMYVAVSDSPNNKATLQY
VKRVDKGNLAIGMTNYVMTASTNSAEKAYYGDANGDGKINIADATAIQKAIVGIVNQNEI
ERINSDVNFDSDITVIDATTIQMYIVGLI
Download sequence
Identical sequences D4L5I3
gi|479150479|ref|YP_007780655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]