SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150538|ref|YP_007780714.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150538|ref|YP_007780714.1|
Domain Number 1 Region: 3-492
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.28e-174
Family Amylase, catalytic domain 0.000000000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150538|ref|YP_007780714.1|
Sequence length 495
Comment 4-alpha-glucanotransferase [Ruminococcus bromii L2-63]
Sequence
MARSAGVLLSITSLPSPYGIGTIGKEARKFADFLKKSGQTIWQILPVGPTSYGDSPYQSF
STYAGNPYLIDLDTLCEEGLLTKEEVMSRDWGSDDAEVDYEKIYNNRFEVLKIAYDNFKK
GDQKAFTSFKRKNSSWLKNYALYMAVKKSFDMVSWTEWPDEEIKMRDEAAVKRYERKLKD
DVDFWKFVQFKFYEQWESFRAYVNGLGIKILGDMPIYVAMDSADTWANPELFQLYDDGDP
IAVAGCPPDYFSATGQLWGNPLYDWDYLEATDYEWWFERIKAASKLYDITRIDHFRAFAS
YYSIPYPAENAINGEWVEGPRIKFFNMMEEALGKIDIVAEDLGTLTPDVTELMEQTGYPG
MKVLEFAFDSGEENDYLPHKYTENCVVYTGTHDNDTVMGWLETAKPEDVNYARSYCQMPD
DEPFNWGLIRVAYESKADTAIVPMQDILGLGKEARMNIPSTLGGNWVWRLDGAALTDELA
DKLKTMSEKSGRLED
Download sequence
Identical sequences D4L5P2 R5E680
gi|479150538|ref|YP_007780714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]