SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150553|ref|YP_007780729.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150553|ref|YP_007780729.1|
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000288
Family Type I dockerin domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150553|ref|YP_007780729.1|
Sequence length 304
Comment Dockerin type I repeat [Ruminococcus bromii L2-63]
Sequence
MKKILAILLVGVMSVTAFGFNASAVEKTDAEIQQEKLGYILNLNKDIWLDCAVIYDGVWP
SIMDNAREVYDTDGLSADEYTVALKQVYDMYYDAPLVNIEYAEATYKNALKEENYNNWYS
ENEWNDFQEKLKNLGDAFDYYYAHKNEFPCNQLTKAFKEMMTSYNKMTNAYTVKGDVNGD
GEVNIEDATLVQKYVAHIENLTGAQKMLTNEKNYENITVTTATNLQKHIVGLEPEFKNND
IFIDEQSCVSSLDDTLRWYNYCNFNICPRRNDVTSGTYIDNNFICMDKIFGYRIWCDKNG
YDYL
Download sequence
Identical sequences A0A1C6FGT3 D4L5Q7
gi|479150553|ref|YP_007780729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]