SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150641|ref|YP_007780817.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150641|ref|YP_007780817.1|
Domain Number 1 Region: 57-199,233-280,311-528
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.33e-66
Family Amylase, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1295-1353
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000955
Family Type I dockerin domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1146-1264
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000012
Family Cellulose-binding domain family III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150641|ref|YP_007780817.1|
Sequence length 1356
Comment Glycosidases [Ruminococcus bromii L2-63]
Sequence
MKKRSMKRALSAVLTLCMALPGASVAFGSASAATVSDDSSTSASSTAAGSLVEDDGFTWD
NANVYFLLTDRFKNGNTANDHSYGRTLDKDGKPLEGWDTNPGTFHGGDFAGVTQSIEEGY
FDNLGVNAIWISAPYEQTHGYCDSGKGFAHYSYHGYYVLDYTETDANFGTKEEFKTLVDT
AHEHGIRVIMDIVMNHTGYNTVADMEQFGFGTLLDGALDFKYKLTDVGEVNDHIDYKTSE
EDWGKWWSNDWIRSGLPGYTEGAGGDLTMSLSGLPDFRTEQTKDVTIPPILKTKWTQEGT
YAQKLAKYGDKNTVTGYLSTWLSEWVREYGVDGFRCDTAKHVDKASWNQLKQACVSALRE
WRSNNKGKAGADWKEDFWMTGEHWDHGVGYDTYYSEGGFDSMINFAVTGGGALASGSVAN
TYQGYADKINTKEGFNVLSFMSSHDETLTRGDENTMLYNAAAFLLLPGGVQIFYGDETNR
PLYPGVAFDGYGGSGHALRSDMNWNDMDKTLLAQWQKVGQFRNKHVSIGAGANVKLSATS
GVAFGRTYDKNGVTDQAAAVIGCNKNSSVTVDVSTLWEDGSYVINTYDNSSSVVTDGKVT
FNSGVNGTILMENADGQPLVSITGEPKFYGTEQVTVSLKECDSAKVSVDGGNKFVVKDGD
TFTIGQTAYKNDTIEVTVEATNDKASSEAKFTFLKLGENDEKPTTSPTQSTTVPGSTASQ
TSKLTIKSTAGAPNVYAWTGASTALNGAWPGQKAAAVSGQANTYELTLPVSADKSFSVVL
NNGSGSQSGDITGLYDGAVLEIQNGNYASVKTVTNGNQQGGGGEPEPAEGSVSVTIKPYS
PSASYKIYAWNDTQKLTGAWPGVALTEKDSDGNYVVKFDNVDEVSIILSSGSGQTADITG
VRDGATIEITNEGCTTYKLTSKPIVVSPYESLKKEARKILAMTASDYTAESWANAQKVLK
SAEAMIKAGEDATTAEDMNAMIADLKSAQKALVLAPATLTYAVVGKSVVSGVTASAAKVT
VTVDGKTYTATADDVTGAFTVATSALKGTSTIKVDATRNGVNGTYSYAMKNGNIENGFVP
TSPTLPTQPTTSTQPTTATQPTTATQPTAPTQPTTATEPTTAPAQKLTVNATSNYFGSAS
KTVSTDGKKVTVLYKLNSNMGVVDGQWAVKYDSSKLKFNMADNKADGKQTIMPSQSNLIH
NAYSNVIKGVFTNPQVPTQYNGDTFISLTFEVIGSGTASVYLDTQYLTLGYVKGNKLNQA
SVVNNSKVCDVTGIAGFEKVSVNASTAFVGDVTLGDVNMDGDITVVDATEVQRYVAQLVA
FTNDQFTAADVDHDGTITVKDATTIQKFVVDLISNF
Download sequence
Identical sequences D4L5Z5
gi|479150641|ref|YP_007780817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]