SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150671|ref|YP_007780847.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150671|ref|YP_007780847.1|
Domain Number 1 Region: 244-302
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000579
Family Type I dockerin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150671|ref|YP_007780847.1|
Sequence length 302
Comment hypothetical protein RBR_07140 [Ruminococcus bromii L2-63]
Sequence
MKNIIKKITAIAMCGVLTVGSVLMTGAVSEDENHKDFEVTGTTQKISNNQLFVTTTGYTE
NTDKNFGAKFQTTEEKDYDIWFKDCINAPRFLNLPKGEKFVKYMMTQGHGYFGNVQTFYQ
FDKTGGEYVKVKIKLSDFSRLFNENGTMTSELSDGSYKDFDFTYEDFGTDSIGVNCYAES
GAYATSGGAVTSFAPDKDGYAEIYVSRQLGEDTKVMSYRYCRLKDGAHCDYGRIGDTLVG
LTCGDTDLNGYISVTDATLVQKYVAGIEDFDKLQLFNSDVNHDGEISVVDATLIQKYIVG
LI
Download sequence
Identical sequences D4L625
gi|479150671|ref|YP_007780847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]