SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150945|ref|YP_007781121.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479150945|ref|YP_007781121.1|
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0611
Family Type II chitinase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479150945|ref|YP_007781121.1|
Sequence length 142
Comment hypothetical protein RBR_10380 [Ruminococcus bromii L2-63]
Sequence
MNDEKKNMCDEDDSDEILEYTGGSKLSDLIFITTYDYYSSWRIKEVFSVAGYDLQPVYLG
YKALRYRPCQRYWIVDKKTNQRIGSSNNGYSFEDLRYFLGGLGIPLHGENYHPTRDKDGR
RTSCKEFLELVESLPDEKEDLI
Download sequence
Identical sequences D4L6U9
gi|479150945|ref|YP_007781121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]