SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150994|ref|YP_007781170.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150994|ref|YP_007781170.1|
Domain Number 1 Region: 161-591
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.06e-109
Family Amylase, catalytic domain 0.0000129
Further Details:      
 
Domain Number 2 Region: 56-162
Classification Level Classification E-value
Superfamily E set domains 5.6e-16
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 
Domain Number 3 Region: 1019-1082
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000196
Family Type I dockerin domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|479150994|ref|YP_007781170.1|
Domain Number - Region: 599-680
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0575
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 
Domain Number - Region: 1135-1213
Classification Level Classification E-value
Superfamily BT0923-like 0.0837
Family BT0923-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150994|ref|YP_007781170.1|
Sequence length 1233
Comment pullulanase, type I [Ruminococcus bromii L2-63]
Sequence
MRLRKPLSILLSLSMIAGMSAFASNAAVTSDESVSAGNYYNANYLESYASKAYNESGLGS
VYSKTSTTWKTWSPDASSVKLKLYTTGSDNEAGASAIGTYDMKKDSSTGVWSLNLSGDYK
NKYYTYLVTVNGTTKETQDVYSQAVGVNGNRTMVVDLDSTDPSGWSDDKHVLFNSASEAA
VWEVHVRDFSVSKNSGVSEDNKGKYLAFAEGGTTLNSDTSSSAVSTGIDYLVEQGINCVQ
LMPVYDYGSVKEDVASSSSNRNWGYDPVNYNAPEGSYSTNPYDGNTRITEFKQMIQALHD
RGISVVMDVVYNHTFSNDSCFNRTVPGYYYRMHSSSAYSNGSGCGNETASDKLMYRKYMI
ESVKYWAEEYHIDGFRFDLMGIHDITTMNDIRSALDGLYSDGSGKKILMYGEPWTGGSVA
ISDGCSQSKAGSLNPRVGMFCDSYRDAIKGSTDGSDKGFVQGNTDKAGTVANGVTGKGFS
AQAPSQTIAYADAHDNLILWDKIVKSNGSSSWNSTSSSLRGQVKKVMGLLLTSQGIPFMT
AGSEFCRTKQGDTNSYKSSDAINEIDWSRVKTYSDVAAYYKGLLEIRENYSPMKSSTFNT
PSFQSTHGDVVAYTYSNNKSNEWGKVCVLVNASSTNDWPITLDGSGWTVVADGTTAGLKS
LGTVSGNTYTVPANSACVLVQSSTFNNLKVSEKTFGTVTIKHIDDSGNVLKTSTAKYADG
TTYRTYPDTTILYDYALKDTQGVTSGTVTGGKNYNVTYVYSSSGIRSGYVTVNYVDENGE
SIKDTVSTKYREGDSYSVPFTSIQGYQLDTDKYPANTTGTFNGTNTTINFVYKALDSTSS
VVHYYNSNNWSNVRCYAYTDGGEEPNGKWNNATVMTSEGNGWLKCTIPASSSYVMFHTDS
QQEPGANETGYLVSGEAWIQNKKLSFSSKVITSHIDAATGEKIADDEILIQSKVSSDDTY
KTSPLSGRTDVIAPVNASGNLSSGIINVVYLYTSSERPSTAPSTVTPTTAPVTQPTEKIL
IGDVNLNGAIDIVDTTAVQKYIVKLITLSDKALIAAARCDADGENDIVSVKDATYIQMYV
AKLDGHGNVGTYYESEVTPTTAPVTEPATEEPTVAPTTVPVTTAPVTEPTTTPSSTYTVK
FTDSLNWDGTLYCYSWAEDGTSTKSWPGVAMTYLNTNDYGQKVYSVEVPNTVDYIIFTNG
SSQTIDIGFDGTSLNYYTESQYDSKGHAYVGSW
Download sequence
Identical sequences D4L6Z8
gi|479150994|ref|YP_007781170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]