SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151023|ref|YP_007781199.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151023|ref|YP_007781199.1|
Domain Number 1 Region: 9-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.9e-81
Family Amylase, catalytic domain 0.00039
Further Details:      
 
Weak hits

Sequence:  gi|479151023|ref|YP_007781199.1|
Domain Number - Region: 361-418
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000198
Family alpha-Amylases, C-terminal beta-sheet domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151023|ref|YP_007781199.1|
Sequence length 427
Comment Glycosidases [Ruminococcus bromii L2-63]
Sequence
MAKNSEISLRKKVIYSVYVRNHTNDGTFNAVVKDLDRIKSLGTDIIWFMPIHPIGVKNKK
GSLGCPYANKDYRTTNPEYGTMDDFKSLVEKIHAKGMKCIIDVVYNHTSPDSNLSVEHPE
FFYRKSDGNFGNKVGDWSDIIDLDYSNKELWQYQIDSLVMWAKIVDGFRCDVASFVPVEF
WKQAREAVAKVNPDCIWLAESVHSSFNVFSRKSGIYTASDYELFDAFDMEYDYDIREVFD
KYLKGETSLSHYLDMFNYQEAIYPQNYDKMRCLENHDQPRICHYVKNRSDLENYTAFLYF
LKGSTLIYAGQEFGCDETPSLFDKDVFPRNTGIDLSNLLAKLDTIKKTVLDDDDYFKADA
DDENDIAILERDNNKSKKVGIFSLKSKSADVKVDLPDGDYKNEISGETVAVSNGKIHCNG
NAIIIRK
Download sequence
Identical sequences D4L727
gi|479151023|ref|YP_007781199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]