SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151210|ref|YP_007781386.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151210|ref|YP_007781386.1|
Domain Number 1 Region: 142-579
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.21e-106
Family Amylase, catalytic domain 0.00000507
Further Details:      
 
Domain Number 2 Region: 33-143
Classification Level Classification E-value
Superfamily E set domains 1.78e-19
Family E-set domains of sugar-utilizing enzymes 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151210|ref|YP_007781386.1|
Sequence length 940
Comment pullulanase, type I [Ruminococcus bromii L2-63]
Sequence
MMITGMCAVDVSAAEKKTVTDYQAYAANLDKSAYSGNDLGASYSKKATTFKVWSPNAASV
RVNIFEHGSDNEGDAGSIMSRAMSLDKTTGVWSVTINGDLLNKYYTYSVTHGKTTKETAD
VYAKACGVNGQRSMVVDLSTTNPDGWENDKHVLVQNQTDASVWEISVADFSSSESSGVSE
TNRGKYLAFTEEGTTVNGVQGASSTCVDYLKKLGVKYVQIMPFYDFGSVDESKNIMDQYN
WDYDPVNYNCPEGSYSTNPKKGEVRIKECKQMIQALHNAGIGVIMDVVYNHTYTSDSWLQ
RTVPNYYYRMNNDGTFSNGSGCSNDTASEHLMFRKYMIDSVTYWASEYHIDGFRFDLMGL
HDVTTMNSIRTALDNLYEDGSGSQILMYGEAWDMATNCDEGTVLASQKNLKQLSDRIGAF
DDTIRDAIKGSTGGTDGAFVQEGSRRANLKTGIAGQSDTTTGWANVPSQCVTYASCHDNL
CLYDKLVGSVYGADGKYRKRYEDLVAMNKLSAAIVITSQGIPFSLGGEEFCRSKDGDENS
YASSRKENMLDWENVDLYSDVIEYYRGLYKIRDAFAAFSDSTAATANSLTYLSDVPKGVT
GYTINNTESGKWSQMCVIFNGSDSAQNVTAKGDWVVLADNKTAGLRNIKNVTNSVKVEAH
SAVIMVDTKSYDSAGIMDDEGAVVIDYYDNKTKKLIKSQTLTGELGTSYDLTNLASTLNY
DVKKTDGEIKGVFTDQVGHAKVYVEEYDGEISTVTVKFVDETNNTEIEDSFLVKNRKGEQ
YYTPDLPSIKNYKLVLDDLPTNGAGKLDSASKTVTYKYTRVTDDEDKTVCRVNAIYMDDS
GKILDTKTITGVEGQAYSLSQNTYEEKDLVSVPEKANGTFKSGEINVVFSYSSNPDPLKQ
MLPFVYVGTGLIIALCAASVIYSSNKRKKRIMAELDIEED
Download sequence
Identical sequences D4L7L4
gi|479151210|ref|YP_007781386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]