SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151288|ref|YP_007781464.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151288|ref|YP_007781464.1|
Domain Number 1 Region: 676-732
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000108
Family Type I dockerin domain 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|479151288|ref|YP_007781464.1|
Domain Number - Region: 586-665
Classification Level Classification E-value
Superfamily PKD domain 0.00824
Family PKD domain 0.013
Further Details:      
 
Domain Number - Region: 254-352
Classification Level Classification E-value
Superfamily CBD9-like 0.0106
Family Family 9 carbohydrate-binding module, CBD9 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151288|ref|YP_007781464.1|
Sequence length 734
Comment Dockerin type I repeat [Ruminococcus bromii L2-63]
Sequence
MKRTRKITSIILAALMVLSALVVSAGGVSAATSSGSEAYFDNSKYGWKDVYVYAYGTKEN
AEWPGELMTKEDSGLYKASFASSFKSEKIIFNNGLEKGNGKEQYPEAAGLSLKAGECKML
TAEKQWIDYGKPDDHAYGYTLTANNTAFSTESLDVKLALKNADKGYYSVDGSAKKEFANG
DSVKVGEGKIGNSKVTLTLYATGADGVETEQTYTFKKTFTASKTTFSAKSDGHTTAPESG
YYGTNPEMQLGKHKTISVDGDLSDWDSSMIIAQGVANDDPRVYMPSSMHEQPWDAYALYS
AWDDDNLYFLLEMANTTYITSPEDNFAASNEARPWRNSIPMYLALSIDPAKQATGKAVGT
NKDGSVYTNPFVWGCTNGTAKDGGTGFTTHIDTLVAFDSNNSNGGASIFKADTQDTDGTY
MFNYDTRIPIGVTSFQAQDNKNGFKIKYANGTKSTSIFGINAPKGSRVMGDNLDMNSNWV
DFFDEGYKNSYGYVYEIAVPLNTLGIDRSYIETQGIGAMQILTYGTSGMDTLPHDPSMLD
QANLEYSYDPSTSHEKEDIDNITVPLARIGALLPDTEVNEAPFEVNFGANLNSGQSAGTP
ITLLAESYHATGDVTYSFTVNGETVQNSNTDSCVWTPSADGTYSIGVVAVDANGNKAEST
KTFVVGSSSSDETLKGDVNRDGSVTVVDATLVQKYIVKLEDFDAETMKIADVNGNGIIEV
TDATLIQKIITKLA
Download sequence
Identical sequences D4L7U2
gi|479151288|ref|YP_007781464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]