SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151295|ref|YP_007781471.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151295|ref|YP_007781471.1|
Domain Number 1 Region: 387-439
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000209
Family Type I dockerin domain 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|479151295|ref|YP_007781471.1|
Domain Number - Region: 75-306
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000157
Family Tricorn protease N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151295|ref|YP_007781471.1|
Sequence length 442
Comment hypothetical protein RBR_14570 [Ruminococcus bromii L2-63]
Sequence
MKRLISLAVAVMLITLLGVCRSRAYDEYNLTDLAACSSVKSDSNGKGGFVCAFSGNTVFS
ARLVPDFSAYNFSVGGRIKSVSQSGNYTYALVFDDVFTNKYSVYSLNLDNGNVSRNTFVD
ENFMTNSFSVTDNRIYYIKTDSLKSYVACRDFSSDKKSKITFSDNVNEVFNNNGKSYARL
CDGSIYKISQSSSTYVADTGELKNIYNAGINRVINEDGFIVSLSDNSRNYVSNAAAENVS
VSDGKVYSAVNYRLNLKTSEKTKSVSISDRATAVVSYKNQCAVLLNNGTVQVFGSGDFEE
KKTSGNDGDNDDHNSSKSDIQPNNSEYLFSDGIVYGIYSGETVADFKNKTSAENVYKADG
TLAKSGKLKTGFTAVIDSKTYVIAVCGDVTGEGNVNSKDVTLLQKHLCDNAELDGAYLKA
ADFNLDGEADNRDLVLISRQKN
Download sequence
Identical sequences D4L7U9
gi|479151295|ref|YP_007781471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]