SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151399|ref|YP_007781575.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151399|ref|YP_007781575.1|
Domain Number 1 Region: 339-526
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.42e-20
Family Terpene synthases 0.094
Further Details:      
 
Domain Number 2 Region: 571-628
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000608
Family Type I dockerin domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479151399|ref|YP_007781575.1|
Sequence length 629
Comment hypothetical protein RBR_15800 [Ruminococcus bromii L2-63]
Sequence
MNKSFKKILSIVLSVMMILSLMTVSLSVSAVEDGKVRVIVRNDTYSVENGAPWDGVLVDE
WVSINNDTTMMSAVADALNNHGYTQEGAENNYISSINGLAAFDGGTMSGWMGTLNDWFTN
SGYASYTVADGTLESGDEIAIMYTSNGYGEDIGGTWANNDTTVKSVEITGAELSGEFDPS
VTDYTLTIDTPSADVNVVPTATNKNFQTRKYKNEYLPSDDSAFYKRSQTVNVSDGDKIII
GCGDIAWPSMNTSEGGTVYTFTVKYAPSAADTVSNKIDEVAKYLASQNTPTVSSVGGEWT
VLGLARAGKITDEIADSYYQNAVKYVEEKGSAKLHNTKSTDNSRVILALTAIGKDVTDVA
SYNLLEPLADMDYVKKQGINGPVFALIALDTGDYEIPQTDAANPTTREKLVQTILDAQVA
NGGWTFFGSTADPDMTGMAIQALAPYYSTNSDVKEAIDKALTAMSNAQNENGGFASWGSV
NSESCAQVLVALTSLGIDPTNDERFIKNGNTLIDAMMSFSAENGFGHTDTTYNQMATEQG
FYAFVSFDRLVNGKTSLYNMTDRLAENYAVGDVNLDNTVSVIDATLVQKQIVNLEQLSKV
SLIKADVNHDGVIDVVDATEIQKIIVKLV
Download sequence
Identical sequences D4L853
gi|479151399|ref|YP_007781575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]