SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151431|ref|YP_007781607.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151431|ref|YP_007781607.1|
Domain Number 1 Region: 147-226
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000118
Family Invasin/intimin cell-adhesion fragments 0.0082
Further Details:      
 
Domain Number 2 Region: 311-389
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000106
Family Invasin/intimin cell-adhesion fragments 0.013
Further Details:      
 
Domain Number 3 Region: 229-307
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000157
Family Invasin/intimin cell-adhesion fragments 0.0067
Further Details:      
 
Domain Number 4 Region: 1-46
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000706
Family Type I dockerin domain 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|479151431|ref|YP_007781607.1|
Domain Number - Region: 447-563
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0451
Family Papain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151431|ref|YP_007781607.1|
Sequence length 600
Comment Uncharacterized protein conserved in bacteria [Ruminococcus bromii L2-63]
Sequence
MDATKVQKYVVGMIDLTDDEKFLYDTNGDNVLTVIDATNIQKIIVGSQFDTSEPSSLTET
TSVYGTEASTETTISNFSSACTEVTTEYSETTAYTETTTECVEETTIVDEPSTESTETTT
EEVTEPSTEEYTEQITEQPTTEPKPTVPPKSVKFNKNGITLGVGESYTLITTIENGDISQ
VEFTTDNNGVITVDDKGKMTAVGIGVSTITAKTYNGLTAKCKVTVKKLANSIKLDKTSII
LGVGEQYDFSSYVPSGTAAYYRSYYSDDPNIAFVQKAGGLMTAKKAGTTTMRCKMPNGTQ
ATCNVTVKPLATSLKLNASEIVLYIGQSFDINSSVPKGTAAYYRLYSSSNSKIAAVTRGG
GVVKGVATGKATVTCTLNNGKKAICNVYIMPQSKKISNVPLIGQSKLPTGCETCSATMLL
NFYGYKISETTFADKYLVKKPFGYSNGSYTGPDPNCAFVGTPYSSNSYGAYAPIMVKCMN
KYLSDKSYKAVEISGKSLEYLSGKYVAQGQPIMVWATINMSPSFKTTTWRVNYTDENAKY
KLGSYYTWTAGEHCLLLTGYDKDYYYFNDPWTNARTRYSKSLVNTRYNELGKQAVVMVKK
Download sequence
Identical sequences D4L885
gi|479151431|ref|YP_007781607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]