SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151573|ref|YP_007781749.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151573|ref|YP_007781749.1|
Domain Number 1 Region: 70-197
Classification Level Classification E-value
Superfamily L domain-like 6.24e-19
Family Internalin LRR domain 0.052
Further Details:      
 
Domain Number 2 Region: 230-286
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000226
Family Type I dockerin domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479151573|ref|YP_007781749.1|
Sequence length 288
Comment Dockerin type I repeat [Ruminococcus bromii L2-63]
Sequence
MKKIVKKSCTFLFVFAMLLSMFCVSFSAETYYYDKNFEFYKNDYSGLTITDYLGTEENLQ
IPSQLIDITVNVIAPSTFSDKTGLVTVSMPDTIQTIGAFAFSNCTNITDVKLSKNLSLCV
LGAFQGCTSLETVDMSMTKVTGLPNQMFYKCSSLKNVTLPETCTSVGSYAFANCPKLESV
YIPASVTEISDKAFKNSSAVTIKGIVGSYAEEYAKANNIPFEGISAYDVGDVNMDGRIDI
LDATLIQKYVAGIVELSAEQKYLADYINDGDITVVDATKIQKFIVHLN
Download sequence
Identical sequences D4L8M7
gi|479151573|ref|YP_007781749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]