SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151650|ref|YP_007781826.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151650|ref|YP_007781826.1|
Domain Number 1 Region: 283-494
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.58e-20
Family BT2961-like 0.038
Further Details:      
 
Domain Number 2 Region: 534-583
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000126
Family Invasin/intimin cell-adhesion fragments 0.0042
Further Details:      
 
Domain Number 3 Region: 206-261
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000145
Family Type I dockerin domain 0.0034
Further Details:      
 
Domain Number 4 Region: 589-665
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000149
Family Invasin/intimin cell-adhesion fragments 0.0031
Further Details:      
 
Domain Number 5 Region: 83-149
Classification Level Classification E-value
Superfamily L domain-like 0.000015
Family Ngr ectodomain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151650|ref|YP_007781826.1|
Sequence length 675
Comment Bacterial Ig-like domain (group 2) [Ruminococcus bromii L2-63]
Sequence
MRNFKKTLSFLLSTVIIVSSVVGVGTTVFAATDEHTYKNFKYRILDDNTAEICGYTGKNA
VVTVPDSIDSKPVTSIGRTAFYSGKIKEVTIPNTVRSIKWWAFYGCESLEKINLNFGLKT
VGYGAFMNCKKLKSVSIPMSVTQICDDSFAVSCSTQKGVFDTYSKQTISTQQYSTDSSFT
LEGYSGTVAEKYCNDNSLNFVSSGNVIYGDVDNNGTVEAADAKLAKSLIDTVPTEEELTA
ADVDDDGKITENDVNLILQAVGNEFYAQLFPCAKAMYSAPDYLSGRTMYCDGDSVAYGSG
TDTMGNSTYSFCNYVAEKYNMTMTNKATPGTTLAIRKDFIGTDHRSILERVREMKGSYDV
ILLDGGFNDLFKNVEMGAMTDINNKSGKYNEYTTAGALESICYFLDKNYKDSIKLFVLCH
NCSTRIKQSQYWSLMKNILDKWEIPYVDLSEETELTGDNEEITTQYFRYNATTKKGDGIH
PLAYANMKIYGPIVAEKLNETVQSKSELVLPKSDISMGLFESYTLNSEITELRGDIEVSY
SSSNPSVASVDENGNIVATGIGDTVITISTSDGKTKNVNVNVKFLAMAVSFGKNKISLSE
GNSSLLNLSVADGEATCSTTYSSTDPTVASVDENSGKITANKTGKTTVSCTTANGVTVRC
LVYVTSSAQTKMQKA
Download sequence
Identical sequences D4L8V4
gi|479151650|ref|YP_007781826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]