SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151704|ref|YP_007781880.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151704|ref|YP_007781880.1|
Domain Number 1 Region: 281-396
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.93e-20
Family Ricin B-like 0.011
Further Details:      
 
Domain Number 2 Region: 50-166
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000000814
Family CHAP domain 0.01
Further Details:      
 
Domain Number 3 Region: 655-710
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000608
Family Type I dockerin domain 0.0031
Further Details:      
 
Domain Number 4 Region: 579-635
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000157
Family Type I dockerin domain 0.002
Further Details:      
 
Domain Number 5 Region: 182-260
Classification Level Classification E-value
Superfamily PKD domain 0.0000693
Family PKD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151704|ref|YP_007781880.1|
Sequence length 719
Comment CHAP domain./Ricin-type beta-trefoil lectin domain [Ruminococcus bromii L2-63]
Sequence
MKRNLKKIASLFISIAMAFSMLTFSCIQASAMTNQEGADWALARIGQWIDTDGYYGAQCK
DFVNAFTQDNFGVTFPGNACDLIYDSLPAGWQRIQNYAEFVPEPGDIAIWGGWNGNPYGH
TAIIVSANLYTFDSVDQNWVNSSSNGSKAARVTHNYTNPVFWGVIRPPYQAKVQNVENPW
INVNGSVFVAGNSVSFNLGATNATNYTIGIDKDGTRMITQDVGTNPSFTFNEQGNYTAYI
TAYNSVSYKDSNTVSFRVIKPQNLGTGFYGVIINTESWKPIGVDEYNVELQSEKGISEQV
WKFERQNDLSYEIKSAKTGWNLDVYMASSTNGTNIQICPDNDGNAQRWYIISNGKAYTFV
PKNALGSAMDLSNNKKEDKTNIQLYTFNASAAQTFSVYKEDDVQLKSPSLTVDPGINGAD
TVFKWSNVYGESSYNLKVWNNKANDGDAYCSDTFEENILSDKVTLSPGYYEAYIIASNYF
ETKQSGIVSFTVKPNVLLDINKKSKTLNVSWDEISKANFYEIDVYNADTDKLLLSYHNIT
DCKYTFDTRPGNYYLMVKSDTNVVSDKKEFVIKNYLSGHVGDINFDGRINKDDVTDLLNG
AMGVAIGLDPNVSDINRDGKVNTLDVYQLNAYLNNSSYKNDYIGSEIVLDYEINDVNTDG
SIDILDATQVQKYLAKIDSPTYVQNKLADCNGDGVINVRDATYIQKTIVKIPVYNLKNS
Download sequence
Identical sequences D4L908
gi|479151704|ref|YP_007781880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]