SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151781|ref|YP_007781957.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151781|ref|YP_007781957.1|
Domain Number 1 Region: 45-369
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.03e-50
Family Amylase, catalytic domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 747-803
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000147
Family Type I dockerin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 416-484
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000295
Family alpha-Amylases, C-terminal beta-sheet domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151781|ref|YP_007781957.1|
Sequence length 1056
Comment Glycosidases [Ruminococcus bromii L2-63]
Sequence
MKKAKKIASLVVASALLTSSFAAITSVNAAEVDSAQTASADSTLRDKVGDGVMLHAFNWS
YNTIKENLPAIAAAGYTTVQTSPVQQPKDYSTSGDVTGQWWKLYQPISFHIAEESWLGTK
DDLKSLCDEADKYGIKIICDIVSNHIANADEARPDTVSNQVKKYEPEFYKKRKTYTRTYK
GDANDSSVQAVVQGHVSKCPDLVTNDTAVQGYIINLLKECIDCGVDGFRFDAAKHIETED
DGEYASDYWKNITTSASSYYTQKTGDDLYIYGEILNNCGADRSYSSYTKYINVTDNRTGD
AVLYNVTRGKASTATNAKYKSGVAASNAVLWAESHDTYEGSSGSSGFSNTAGISDENVVK
AWAIVASRKDSTALFFARPGTALMGNISTDSTYKSTAVSEINKFHNLFVGQSEKLGSSGD
IAYVARGTSGIVLSNCKGTNASVSISGTGLADGKYTDTVSGAEFTVANGVLTGSIGDTGV
AVVYNGTTTPKAINSVESGSFRGDTMTLTLSLENATSGTYCLDDSTPVKFTGTTSIRIGS
DYKPGETINLTVTATDGVKTSSMVYKYAKSTAQESGVYVFFNPANKKGWSAPYQVYIFDE
TTNKGTVYKNANWPGEAMTLDPATGYYYYEVPKSSSISADEDDENQAASDFDLSTSANTR
VIISEKGGEQYPGRTGTPISLNGSSKAFSLTKAGTWEDTTLTPTKVEIEATDVTKGSAAE
PTTKPVPPTQPTTAQPATEPSGNAVYGDVNGDGDITVVDATLVQKHVVQLETLSADKQIL
ADVNGDNTISVVDATLIQKYIVQLKDWGRTGDVYQAEQPTTPEPTTAEPTTVKPTAQPTT
KPADTYTLYFKTKLGWMTSDGVSLFAYDLDTGASYQFEQDTDAYPNVYTVEVPATVSNVS
VYRSLSEVDEKPVGGDDGNVYNCWDATVSKTNNCITLSNDEAVSTAPYVPEQKPAFTLSR
VYFDNSKAHYTDVYIYGWAESGLGNAAAHMNKIAGTDIWYYDFDTPLSPGSNCFLFKDTE
STWKTQTSDLTVADGKNCFRANPGSKSGGVWVSYSE
Download sequence
Identical sequences D4L985
gi|479151781|ref|YP_007781957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]