SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479151211|ref|YP_007781387.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151211|ref|YP_007781387.1|
Domain Number 1 Region: 180-617
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.58e-105
Family Amylase, catalytic domain 0.00000479
Further Details:      
 
Domain Number 2 Region: 59-187
Classification Level Classification E-value
Superfamily E set domains 4.76e-16
Family E-set domains of sugar-utilizing enzymes 0.0069
Further Details:      
 
Domain Number 3 Region: 802-859
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000617
Family Type I dockerin domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151211|ref|YP_007781387.1|
Sequence length 1059
Comment pullulanase, type I [Ruminococcus bromii L2-63]
Sequence
MRTTKKIVSAVLAACMLASTAVVSSFAATADDSSAVSSDYARDNSYTKAAEDIDAQYAYS
GNDLGVTYTKDATTFKVWSPTATGVKLNIFTKGSDDEQGASKVASYTLEKMLVDGEWNGV
WTITLVGEWKDYYYTYSVTTTDTTHIGSDATKTYETQDVYSTATGVNGKRSMIVDLDETD
PEGWSNDSHVLLDKSTKSSVWELHIKDFSYDKASGVSDANRGKYLAFTENGTTLNGEGKV
STCIDYLKELGVTTVQLNPFYDFQSVNEAGDDSQFNWGYDPVNYNVPEGSYSSNPYDGKV
RIKECKEMIKALHDAGISVVMDVVYNHTYSTDSCFQYTVPNYYYRMKTTGAFSDGSGCGN
EGATERAMYRQYVIDSLKYWVNEYHVDGFRFDLMGLMDVETMNMAREALDQIDPRITMWG
EGWAGGDSYHPTNTCSGTKFYPATQANASRLSDRIAIFNDGIRDGIKGSAMDISDVGFIQ
GSKSSAKGVSYGVRANSSGTYKWKAQAPSQCVTYDACHDNATLYDQIIASTGLADYGERN
SEAVKMNRLASAIIYTSQGISFTLAGEEMARSKDGDTNSYKSAANLNMIKWQNVVDYADV
VSYYKGMMQIKSAFSPLTAMDNSYADKYTFTKKVSASTNQISFTIQNDVEGEWNKMAVIY
NNATTAADVTLSDTSVTDWVVIANGETAGLDSLGEVTGSTFTVPARSAIVAVDKAGYESA
GIHSSKGKVKVNYVYEATGEKLEDSVILQGSVGSGYVTVPSAVIPDTYIVSRIGGNAEGK
YTSDMQEVTYYYTDYIPESLKNADFNGDGEINVIDATLLQKYIAKLETPTVDESTLDLNY
DGTFNIEDSTMIMKYVARIPVSSGKVTVNYYYTDADGKQQKLTDSIVFAGRAGSTYKSTA
FKVVGYAVDPDRMPENQSGLIPYGEAEVNYYYIASSLDIKLHVKHNGSLTWTPYLWIWGS
DLKGKDSGNFMSEWPGDPMTEGENGWFDYSFTYKGAGTYNVIVSDNATNQTIDYKGFVDN
EMWIVIDDSAVMGSTYLTFYTDNPDTNPNAPIAEQVTLG
Download sequence
Identical sequences D4L7L5
gi|479151211|ref|YP_007781387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]