SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379731819|ref|YP_005324015.1| from Saprospira grandis str. Lewin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379731819|ref|YP_005324015.1|
Domain Number 1 Region: 201-350
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000197
Family Tetratricopeptide repeat (TPR) 0.0085
Further Details:      
 
Domain Number 2 Region: 40-275
Classification Level Classification E-value
Superfamily HCP-like 0.000000785
Family HCP-like 0.027
Further Details:      
 
Domain Number 3 Region: 350-537
Classification Level Classification E-value
Superfamily TPR-like 0.0000332
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379731819|ref|YP_005324015.1|
Sequence length 1061
Comment hypothetical protein SGRA_3715 [Saprospira grandis str. Lewin]
Sequence
MKPSTIYYSVLLGLFCLFAAPHLSAQSCPQQDSSQAFAAFEAAKKAMGQGQAGQAFDQME
KAKKLLAQAGCWENWTRISYNKAIMHKRAGQMQAMKNELRLAQTTALQQLPENDPWQGHI
AYLFGRFYMGQGALDTAKLYFLQSRFTYKFAQSWKDYAQASRALAETSLYMQDYRLMERY
LDDAFTITQEQLNNDLPSLRKILQLYGALYYRTGDYESALDRTKTTLEIVKEAMQSRQDS
IEVASYYNNIGLLYIEIGDVDKAEDYCRNALNLSSQLGDLFRIANTYTNLAELTRKKAAY
SRAYNNFKKAEDALNRMSPKEQAANAAIQARIQLNLGWAEVAWEIGKKKEAFALLAQTEN
WQKRLRFKTESTFLLYGRFFRLQKDWEQAKNKLDKALEEGQKTYSSGKHPDLARIYLERA
LLFAQQPKTEIGQALMALEQATEALQMKAGLAATEELSAVSDRELLLEVMEVQIKLYDQA
GQEEMAYRLALKAASLAYELRNSFKSEGSRLFLLQRLIPIYEQALAIVYKRYQKQPKTDY
LLEAFQLVERSKALLLLEALQTENARAFGGLPKKLLKEERRLSRELAKKRKQYFEAQLAN
NAAQMDALDKELLALKRESQRLQDTLEANYYDYFRLKYEDKTPSLEQLQKKLDTGERFLE
YFSAQDGFYLLALSPKSGELFYLPKGEDFNRKMRNFRLALTNSSWLKEEQKTLALKQLLI
AEGWDLYQQFVAPALKAEGIDKILLVPDGLLNYIPFEVLLSEAPAPEEVRQPSFKTLPYL
LKRYNVHYHYSAALLLYERPKIKSGRVLGMAPSYAYDAAAHASGTDSRQHHIRSSVDDLP
GAKAEIQQLSKAFKGLFLYGQQANETEFKKQISKEEYALIHLAMHGWVDEERPEYSNLVF
SHRHDSLEDDLLHAYELNLLKIKANLVVLSACETGFGKYERGEGVVSLGRGFMYAGVPAL
VMTLWPINDQATAILMQDFYEGLSAGKSKSEALRQAKLNYLDAAGDISSHPFFWASFIEL
GDDRPIKLSRAGNWKLYLLLTALIILLLGLLARYFRPQSGN
Download sequence
Identical sequences H6L701
WP_015694020.1.67438 gi|379731819|ref|YP_005324015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]