SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387130015|ref|YP_006292905.1| from Methylophaga sp. JAM7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387130015|ref|YP_006292905.1|
Domain Number 1 Region: 253-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-59
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 6-234
Classification Level Classification E-value
Superfamily PP2C-like 9.42e-46
Family PP2C-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387130015|ref|YP_006292905.1|
Sequence length 642
Comment Serine/threonine protein kinase [Methylophaga frappieri]
Sequence
MVALAVRYGQQSLAGAKAENQDALGCLVPDNPVMLESKGIVCALADGISSSERARQASHA
AITGFVEDYFSTPDSWSVKQSGGKVLTAINVWLCGQGQHFRDSSRGWATTFSGLILKSST
AHLFHVGDARIYLLRGQSLEQLTADHRIRISDERAYLGRALGVDYALDIDYKSLPIEAGD
CFVLLTDGVHEWLSDAELKHLLSEKADLQELAEHICQQALARGSDDNLSCQLVEVTQVPQ
PDADEAFARLTALPFPPELYEGVILDGYRVIKTLHASSTSQLYLAIDTDNGNKVVLKTPS
VNFEDDPAYLERFQLEEWIGRRIDHAHVVRVIEQQRPRRFLYYVLEYVEGRTLEQWLDDE
GSLSLQTVRQILPQIISGLRAFHRLDMLHQDIKPANILMTDDGVLKIIDFGSTKIAGIAD
IVSPVERQALLGTRHYSAPEYLRGEPGSPQSDQFSLGILVYQLLSNRLPFGEAYAKIRHP
QQLNRLQYQSLSEYQGDIPHWVDKAIRRTVAMNPERRYEALSEFEADIKKPNPSYLHEER
PPLLERNPLAFWRTFSLLLVLSNLLLLYLWLTVASATSVALDAEQVEMFDNWFVEHRHAL
ASEVGQMTSTAASSGLVKGMPINLSCSQLQMRQPMSLTNAGV
Download sequence
Identical sequences I1YH25
WP_014703638.1.84016 gi|387130015|ref|YP_006292905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]