SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336116055|ref|YP_004570821.1| from Microlunatus phosphovorus NM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336116055|ref|YP_004570821.1|
Domain Number 1 Region: 1-420
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.22e-79
Family Gtf glycosyltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336116055|ref|YP_004570821.1|
Sequence length 436
Comment glycosyltransferase [Microlunatus phosphovorus NM-1]
Sequence
MSRIIFATTPADGHTVPALPIVRALIERGHSVRWYAGRKYADRIQAIGAEYLPMSDHDFS
LVGLDDFFPQRAELSGLAKLKFDMAVAFSQPARTHLADLLAALEDEPADLIVGDTGLIAG
PMLSELGGPPFAAFGVSVVGFPSRDVPPFGLGLRPTTGALGSLRNQVLHTLVRRTLFAGM
TDAVNEVRADFGLPARDEIVFEYMLHASLYLQLGAKGFEYPQRNLPEHVRFVGPVRPLPV
QGWTEPDWWSDLDAGKPVIVLNQGTVATDPTELLQPGLAALAGEDVLVVAVTGGRDPREL
GPLPANARVERFIPFDRLLPRADVLVTNAGFGAVQLALAAGVPIVAAGKTEDKVEVAARV
GWSGVGINLRTQTPRPEAITAAVRQVLGDERFRRRAAELQLEIASTGRELAAAEELEKLL
SGAATDRGSRPSRAGR
Download sequence
Identical sequences F5XJ92
WP_013861307.1.71618 gi|336116055|ref|YP_004570821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]