SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336118522|ref|YP_004573291.1| from Microlunatus phosphovorus NM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336118522|ref|YP_004573291.1|
Domain Number 1 Region: 14-211
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 0.00000000000017
Family Archaeal IMP cyclohydrolase PurO 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336118522|ref|YP_004573291.1|
Sequence length 228
Comment hypothetical protein MLP_28740 [Microlunatus phosphovorus NM-1]
Sequence
MSTTVISELQHDDYPGRGLVLARTPANGVCVVYFITGRSRASRDRALVRAGDSVYARSRS
AGAHDPLRHYRAVAVGSKWCVIGNGDQVDAVVANLESVGPSEAVQGIEYEPDPPLRTPRI
TLVAPRQTGSPLYVSAARASILDPEVTHLSCLTVSDLPEGCGVLTTTYYGIGSEIDTSRP
PLEFSTDVGSASELLTAVWESLPADLRVAAIAVQPTSRDPLALPARMA
Download sequence
Identical sequences F5XJI8
WP_013863757.1.71618 gi|336118522|ref|YP_004573291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]