SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336119157|ref|YP_004573932.1| from Microlunatus phosphovorus NM-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336119157|ref|YP_004573932.1|
Domain Number - Region: 326-499
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.0122
Family Gtf glycosyltransferase 0.079
Further Details:      
 
Domain Number - Region: 435-479
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0293
Family FIS-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336119157|ref|YP_004573932.1|
Sequence length 506
Comment transcriptional regulator [Microlunatus phosphovorus NM-1]
Sequence
MAIRLSDLLSDSALGLQLLTGQAGAEIGWAHSSDLMDPTPFLEIDNLLLTTGTQFGGETS
PAGYAAYVDRLVTVGVTALGFGTEVVRTTPEPLITACAERGLPLVEVPYRTPFIALARRV
ADALAEQDHARDLWALETQRALALAALSANRIAAVLEELSRRLRAGVLLLDAHGEVLSEH
GPHRLAGAELSAVQGEARRLLQRRLRSGSALDLPGPSDHPESVRRTVTMQTLGRRHELRG
VLAVSLAERPDTAATAVITNAVALAEFAVEDAARREESTLALNAQLFQLALAGHVDAAAD
VLVAAGRQLPEGPVRLLLTPLRTDTDAGELEHALSVRMARAQRSVLATRWHGRFAVVIGD
AMADLAAAVITARQTPVVMSRPVGWPDLIAALHETREALDAAPPTAQVIELETSAILGLL
SRDEIETLAQERLAPLLAAPDGADLRRVLETWLRHNAAWDPAARELGMHRHTLKAQVKRA
GSLVRLDLDTFEAKAELWALLTAAPA
Download sequence
Identical sequences F5XN79
gi|336119157|ref|YP_004573932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]