SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389862985|ref|YP_006365225.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389862985|ref|YP_006365225.1|
Domain Number 1 Region: 12-198
Classification Level Classification E-value
Superfamily PhoU-like 0.00000159
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389862985|ref|YP_006365225.1|
Sequence length 205
Comment phosphate transport regulator [Modestobacter marinus]
Sequence
MAFRLTPKDSSFYDMFTVSAENLVEATDVLSTFVHEHTRREELGRTLRDLEHKGDQATHA
IFRQVNSSFVTPFDREDIYNLASDLDDVMDCIEAAADLVVLTKLGTLPAEMGQQVALLQR
CAHVTAESMPRLRSMKDLADYWIEVNRLENEADKLYRRLLSRLYSGEFDALEILKLKEVA
DQLEEAADAFEHVANVVETIAVKES
Download sequence
Identical sequences I4ETL9
gi|389862985|ref|YP_006365225.1| WP_014739336.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]