SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389863311|ref|YP_006365551.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863311|ref|YP_006365551.1|
Domain Number 1 Region: 35-275
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.02e-26
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389863311|ref|YP_006365551.1|
Sequence length 280
Comment hypothetical protein MODMU_1615 [Modestobacter marinus]
Sequence
MLACLAAAGVLAGCSSADPGTPAGAASGAPAGALPSAHIHGVGIDPGDGTLLLATHDGLF
QVEEDGKSTRVGPVIDLMGFAVAGPGKYLASGHPGSGVDLPEPAGLIETTDGGRTWRPVS
RQGESDFHALTVSQAGVLAYDGALWRSTSGEEWAEVAIPFEPAALAASPDGQQALATTQQ
GLLRSSDAGSSWSEVDGAPLLQVVDWAPDGATVAGVDPAGQVWMSADSGMNWQEGPQLDS
APQAVDVSVTDAGTRVVVVTTDALLESMDSGGSFDVLLEN
Download sequence
Identical sequences I4EUJ5
WP_014739660.1.28377 gi|389863311|ref|YP_006365551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]