SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389863778|ref|YP_006366018.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863778|ref|YP_006366018.1|
Domain Number 1 Region: 85-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.57e-22
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-17
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389863778|ref|YP_006366018.1|
Sequence length 227
Comment GntR family transcriptional regulator [Modestobacter marinus]
Sequence
MKGDPVVLRRIHASSLADLAYERLTDALLSGDLAPGDRLVQDVLALRLGISRTPVREALQ
RMEREGTIRAGEGRGYVVPDLTSTDIGHLYEVREAVEGQAARLVAARAVASVDEIEATLR
RLSAGAGSSGPDVFRANRLAHRAVVEASGNPFLLELFDDLWGRSVTMQAWGDYFTSVHAD
IDLVTDHADVLAALRSGDPDRAAAVMVEHVRGGLSRHRDHPPDPALG
Download sequence
Identical sequences I4EVW8
WP_014740126.1.28377 gi|389863778|ref|YP_006366018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]