SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389864844|ref|YP_006367084.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389864844|ref|YP_006367084.1|
Domain Number 1 Region: 175-339
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.26e-29
Family Thiamin pyrophosphokinase, catalytic domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389864844|ref|YP_006367084.1|
Sequence length 394
Comment thiamin pyrophosphokinase, catalytic region [Modestobacter marinus]
Sequence
MRIGTLRRGRATETAPGVAGTARLDRRTKNLTKRLRPGDIAVIDHVDVDRVSADSLVACK
VAAVVNAAPSTSGRYPNLGPGILVEAGIPLVDGVGKEVFTRVKEGVELRIEGNQVFAGDQ
VVAEGVEQTPDTVAEAMAEARAGLSVQLEAFAANTMEYMKRERALLLDGVGVPDVTTQIE
GRHVLVVVRGYDYKEDLQALRPYIRDYRPVLIGVDGGADALIEAGYQPDMIIGDMDSVSD
SVLRCGAEVVVHAYADGRAPGLQRVLDLGVDAITFPASATSEDIAMLLADEKGASLIVAV
GTHATLIEFLDKGRGGMASTFLTRLRLGGKLVDAKGVSRLYRSRISTLALVLLVLAALAS
IVAALAVSTASHIYFDLLVDQWDSFVFWLENLFT
Download sequence
Identical sequences I4EYZ0
gi|389864844|ref|YP_006367084.1| WP_014741190.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]