SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389865807|ref|YP_006368048.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389865807|ref|YP_006368048.1|
Domain Number 1 Region: 101-249
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000133
Family Sortase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389865807|ref|YP_006368048.1|
Sequence length 251
Comment peptidase C60 sortase A and B [Modestobacter marinus]
Sequence
MRIEGVYPPPLAPPPSADLLGVDLTSYPRVTRYDRSRPSWPVAARAWTGVSAVLAVAGVT
AVVLAPSDRPAPARLDVPVVAAVAPVAVPAGGSSTAPVLQLPASAPIKVRIPALGVTSKV
MELGLERDGSMEVPPGAYPVGWYDRSPTPGELGPAVLAGHVDWGGEPGAFYGLRELLPGD
QVVVQREDGSTATFAVDRVEEHEKDGFPTDEVYGDVPYAGLRLITCGGTFDEDTGNYEDN
VIVFATLLATS
Download sequence
Identical sequences I4F1R6
WP_014742148.1.28377 gi|389865807|ref|YP_006368048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]