SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389862301|ref|YP_006364541.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389862301|ref|YP_006364541.1|
Domain Number 1 Region: 241-409
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.23e-21
Family Nuclease 0.024
Further Details:      
 
Domain Number 2 Region: 16-263
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.46e-19
Family Phospholipase D 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389862301|ref|YP_006364541.1|
Sequence length 534
Comment phospholipase D [Modestobacter marinus]
Sequence
MDDAEHWLLTADERGNRASGLPAWTSGNRVEALVDGATYFDRLVSAVEELGVGDHLMFTD
WRGDPDERMREDGPTVGELFGSAARRGVCVFGLVWRSHWDGLSFSKEENAALDEAVEDGG
GVVVLDQRVRRLGSHHQKIVVLRHPDDPDRDVAFAGGIDLCHARRDTYEHRGDPQPQSMA
EVYGPRPPWHDVQLQLRGPVVGVLDTVFRQRWEDPHGPDTDHPLAWVHDKLSSSRMNAVP
LPEQPPPPPECGPHLVQTLRTYPAIKPAYPFAPHGERSVARGYSKAINQARRLVYLEDQY
LWSTEVAHLFAEALRAHPRLHLVVVVPRVPDQDGAIAERPQYVGRHQAIETCRAAGPGRV
HVFDLENDEGTPVYVHAKVCVVDDVWVSVGSDNFNRRSWTHDSELSSGVLDTTRDAREPR
DPAGTGYGARVLARDLRLRLAREHLGRAVDGGGDGRADDDLLDPEDFVATLARSATALQE
WYDGGRVGPRPAGRLRPHRPEKLSRLTRIWATPIYRLVNDPDGRPLRLRRAKEF
Download sequence
Identical sequences I4ERM9
WP_014738652.1.28377 gi|389862301|ref|YP_006364541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]