SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389864729|ref|YP_006366969.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389864729|ref|YP_006366969.1|
Domain Number 1 Region: 264-435
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.17e-23
Family Nuclease 0.034
Further Details:      
 
Domain Number 2 Region: 38-286
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.42e-20
Family Polyphosphate kinase C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389864729|ref|YP_006366969.1|
Sequence length 552
Comment hypothetical protein MODMU_3058 [Modestobacter marinus]
Sequence
MQQAGAAALRREPRWARTLRGGEEPWLLSAGQRGNDAAGLPVWSEGNDVQALVDGRSYLP
VLADALAGATAGDAVLFAGWRAEPDEFLDDAGPPVAAALVGAATRRAVVRGLLWRSHSEV
LGYTYRANRDLAVAVNAAGGQVLLDHRVRPLGSLHQKFVVRTRLGAPDDASTDKDVAFLG
GIDTAHSRRDGSTHPGDRQARPFSAAYGPTPAWHDVQLQLRGPVVRDVEAVFRQRWKDPA
PLTRWPWQTVPDRLAGLPRTARPLPAPAPPPAPAGTCTVQLLRTYPPRRPAYPYAPDGER
SVARAYAKALARARRLVYVEDQYLWSRDVARVFAAALRRAPGLQVVAVAPRYTDKEGRAD
VLASMLGQNSAWRAVLAAGGDRVHLFDLESPAGRPVYVHAKVCVVDDVWAAVGSANLNRR
SWTHDSELTAAVLDEQQDGRDPVDPGGLGDGARTFARDLRLTLMREHLDRADGDDADLLD
PDDAVQAICGAAEELDGWHAAGGAGPRPNGRLRSHPRRSSGGTLRRWLVTPLYDLGYDPD
GRPWRMRLRGGH
Download sequence
Identical sequences I4EYM1
WP_014741075.1.28377 gi|389864729|ref|YP_006366969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]