SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_01537T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_01537T0
Domain Number 1 Region: 601-836
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.65e-57
Family ABC transporter ATPase domain-like 0.0001
Further Details:      
 
Weak hits

Sequence:  WUBG_01537T0
Domain Number - Region: 507-534
Classification Level Classification E-value
Superfamily SOCS box-like 0.0366
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_01537T0
Sequence length 922
Comment | WUBG_01537 | Wuchereria bancrofti hypothetical protein (923 aa)
Sequence
FLIPVILVFGVEVYSKFFSKHYSSYKPETAPPLELISGIYGNWTLSYFSLENQNKATKGE
EYLKAMTSFPGIGVRCINHNPVSPTLDGTIYPCYINATFLTNLTLPSKLVPFNVPQKCGC
DSSGWNCTTTNDFNYELNNVTLPTANIIYDVTYRNISQFRLLTCDLAVKNSFMLVVALLR
IGGWQFAQFSTVALNDTEKSYAQIGWHNLLSFMKKAAKVWKIDWQHAIANVSFFENPFKP
RNRTFKDLVAVSMANFDTEENSKIWFNNKLWHSLPIFTNAYHNAILRSQSSSDPANIGIL
TYSHPMNYSLSSYINNIPLVRIISFRIILLLLAISLFTACFCLPLVEERVSLSKHLQMIS
GLTPLIYWFANFIFHTIIYLIVAVIIIVSYNIMAVDHFVIIPFYSVSLFTLLFCAGLSLI
SLTYLCQTLFSLPSLAYIVIGVVFFFIGANCIMIVIFLENQMLKDEALVIAYQICSVLFI
ALPHYNLGMAAYRLSFVGVLRMQSELYLKDINRKDQINHLPLPNPLEWHLMGKHLIALII
EFCLCLLMLLLIEYRYCLNSWMKHSEFVRTTQLIANTEESELDEDVKAEHARVDALSSEP
NEDHRLIVSDVSKSYDGQTLAVRNVSFAVKNGECFGLLGVNGAGKTSLFRILTGQVSVGT
GDILINNKSIQCESSSSLTSCGYCPQFDALNPKLTAREHLRHYSLLRGVKKEDVDMVVNW
ALSKLQLNPYADEIASNYSGGNKRKLSVAIALVADPPLLLLDEPSAGMDPLAQRFMWNIL
LALRKNKRAMVITSHSMEECEILCNRIAIMNHGQLRCVGSIQHLKHRFGEGYTLTIRLST
NESISKVQSFMETLLPVARLEAVHFLTMFYQIPNVSCTIADAYDVICKMQETIQIDDYSL
SQTTLDDMFVSFVNSSSDKTAG
Download sequence
Identical sequences J9FJQ9
WUBG_01537T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]