SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_02646T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_02646T0
Domain Number 1 Region: 28-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.3e-43
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 2 Region: 229-455
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.55e-19
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 505-550
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000719
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_02646T0
Sequence length 558
Comment | WUBG_02646 | Wuchereria bancrofti hypothetical protein (559 aa)
Sequence
TRPDWTSSSIREFEEESIVVESNVTVGVACRLGNVELTQQLLHAGYGAFPDDRSWWPIHE
AAYGLHLECCKVLVESGRCNVNAQAHDSVTPLMLVCRMSSRHNEALEVARYLLDNGANPN
GRTLDEMTPLIQAIKSKNTALALLLIDRGASPLDVWYDGWSALHESADTKNLVIMQRLIG
LGADIFAVDVKRHTALMVAVQENFFPGVKLLLKVARDRAAELADISVENGLTCVMAAADA
GFEDILLLLINHGADCNITLHPIWGDDGSRIHAIAAAALNNHPKCVELLIPHVNKEILKE
TEIDPVSAAAYSGSYECICLLLDAGFSTEVPMCSCEPVGMIIPYLRPLFSRRYHTPLREA
VRKGYTLVVERLLKAGAKMTYVKNCFSPFLFAFRNRIDPAILYKFLENDVDINAMSVKRT
CDVPDALVSALGTCNRRQLLLLLSCGLDPALKNWCKCNNGYSLMYDVMQTTYVTDVDKLM
KLLILFSSGIPSCCNEVAEVIGAQPKIPELLHLCRLAVRKCFPTSKLLHGRFLDYLPIPK
SLRDYMIFHPIPEELRPS
Download sequence
Identical sequences J9EW78
WUBG_02646T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]