SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_03899T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_03899T0
Domain Number 1 Region: 49-88
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000017
Family SOCS box-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_03899T0
Sequence length 90
Comment | WUBG_03899 | Wuchereria bancrofti hypothetical protein (91 aa)
Sequence
MSRYRIGQHSDKLASFQGYGKQMQLQFYSDTYGMFLFSVQIRRLSAGAEPLTLLELCRRS
IRTYLGKGRICRVRELRLPAGLKKYLLYKC
Download sequence
Identical sequences J9BDD8
WUBG_03899T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]