SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_04341T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_04341T0
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-20
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 2 Region: 205-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 158-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_04341T0
Sequence length 246
Comment | WUBG_04341 | Wuchereria bancrofti low-density lipoprotein receptor domain class A containing protein (247 aa)
Sequence
MDGTQAKKIVTENLVWPNALAIDYFAERLYWADAFRDVIEMANLDGTGRRTVISDDKLVP
HVFGLTIFDDTIFWSDWTRRGILFADKLTGQNSTRLMKTVLPPYSLKAYHSFMQMAAPNI
CEVTTCQHICAPKLDGSGQQCLCAEGFIMHESGLCEPNCTKHQLLCSRPDHKCLSLIYRC
DESYNCRNGDDEMECPVSICMHDERMFPCRDNRKCILRSQRCDGFVDCYDESDEFYCADL
AIAWSH
Download sequence
Identical sequences J9BC56
WUBG_04341T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]