SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_04627T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_04627T0
Domain Number 1 Region: 12-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-35
Family G proteins 0.0001
Further Details:      
 
Weak hits

Sequence:  WUBG_04627T0
Domain Number - Region: 185-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000107
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_04627T0
Sequence length 280
Comment | WUBG_04627 | Wuchereria bancrofti Ras family protein (281 aa)
Sequence
MRIGASELCREEHEYMLKFLLVGDSDVGKDEIADFLRPSVSYTPDALFIPFAVPKTTVIL
LEGKFVRLELWDASGQGRFSTIIKSYSRGVQGILLVYDITNRWSFDGIRRWLAEIDEHAP
GVPKILIGNRLHLEFNRAVPRREAECFARKRNMQYFEISTLAYFNVHESITELARLVISR
NGMHRLWKCAQVASLQDLCCRAIIKNISNVHAIDRLLLPSFLQLKVRSFASGTDLCMRSV
IRRQYATPYFSSASKYITRFVRARDTSTKDHLRKANCDLM
Download sequence
Identical sequences J9BBE6
WUBG_04627T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]