SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_05195T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WUBG_05195T0
Domain Number - Region: 61-82
Classification Level Classification E-value
Superfamily SOCS box-like 0.0811
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_05195T0
Sequence length 85
Comment | WUBG_05195 | Wuchereria bancrofti hypothetical protein (86 aa)
Sequence
MSQKHLLPLQISKPKACSCTKTMQHSDHRYGLKSLKNLYGKKLSGGISQRALDDTELRHR
STPASKKSRLPMPNRLVGYLSKSSA
Download sequence
Identical sequences J9F949
WUBG_05195T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]