SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_00681T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_00681T0
Domain Number 1 Region: 200-370
Classification Level Classification E-value
Superfamily Lipocalins 3.88e-22
Family Rv2717c-like 0.0058
Further Details:      
 
Domain Number 2 Region: 112-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000931
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 40-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 75-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000492
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_00681T0
Sequence length 388
Comment | WUBG_00681 | Wuchereria bancrofti hypothetical protein (389 aa)
Sequence
IKCTEKPCENGGRCRLDTGAEVGFTCSCKEGWTGPLCQTKDHCVGHSCVSGKCVNQKDSY
QCVCWKDYAGKFCTRKCDPNLCSRNGTCVEKSSGELGCKCPPGASGRYCEREINECNFRR
CKNGAKCTDKWNDYSCICRPGWMGKDCDRPCQDIYGSCDQWKKQGQCEQMRDHTRFFDDN
CAASCGQCTYSNETVKTTKPLAPILLPLSWMIGIWKAEVNGTRSRTIDYVTDFKGISYTE
ILTITVADVLVFGKPSINFTSIATNRNDTTDQHIHYGFFTVSPNLDGKPLVALITASNLG
QIMIEEGELRSNSIQLTPVYRSVLSHTANSLPLEGDSNVQEKSLYFQLHRTFSRTDKRLV
QSLTKKDLDGRNRSISKRYDKIVNIEYL
Download sequence
Identical sequences J9FLY2
WUBG_00681T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]