SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_00827T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_00827T0
Domain Number 1 Region: 962-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 2 Region: 296-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000949
Family EGF-type module 0.08
Further Details:      
 
Domain Number 3 Region: 851-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.00085
Further Details:      
 
Domain Number 4 Region: 752-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 1010-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 6 Region: 458-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 411-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 924-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 9 Region: 808-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 355-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.035
Further Details:      
 
Weak hits

Sequence:  WUBG_00827T0
Domain Number - Region: 714-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 111-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00765
Family Galactose-binding domain 0.063
Further Details:      
 
Domain Number - Region: 1124-1346
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0732
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 
Domain Number - Region: 1537-1637
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0961
Family Fibrinogen coiled-coil and central regions 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_00827T0
Sequence length 1649
Comment | WUBG_00827 | Wuchereria bancrofti laminin subunit gamma-1 (1650 aa)
Sequence
ILHRQPCRTNLRVLQLIYILIWIFETVLAQPAEQNPSIDPNHHIPGSSPCYDDMNIPQRC
VPDFINAAFNLQVEVTNTCGVNGPVSYCVQTGHSGVRKVCDICDSRVEAYAHPPAYLTDF
NNANNETWWQSETMNEGMQYPNSINLTLRLGKTFDITYVRLKFVSPRPESFAIFKKTHPD
DDWIPWQYYSGSCRSTYGILEKAPILPSNEAVAQCTREFSDISPLTGGNIAFSTLEGRPS
SQNFEESETLQEWVTASEIRIMLTRMNTFGDEVFRDAKVLRSYYYAISDFAVGGRCKCNG
HASECVKSTGDGEDRLVCRCEHNTMGADCDQCLPFYNDRPWRVGTAKEANECITCNCSHL
SNRCYFDQALFERTGSGGHCIDCAGNTQGAHCEECAPFNWRRPGEHYCIPCQCNEIGSLG
MQCDDHGQCPCKPGVGGHFCDHCMSGYYGFSISGCKNCLCDKTGSLNNEPVCDSETGSCS
CKLNVEGQQCNKCKPGYFDLSLDNQFGCTPCFCYGHSSICTSADGYYGMNVSSRFDSGKE
FWSAASLRGPEDIQWAEMDKAIVVSDIDGSPVYFVAPTQFTGDQRASYNQDLWFTLRVQK
AQVHPSARHVLFFIQDILIVGQEGQELTIPIFAQENPIPSVNEQTYRFRIHANPVFQWSP
RLNELDFIGILSNVSALKIRGTYSTEGDVGFLSNVHLGSAGLATSADEPREAHWIESCNC
LEGFIGQFCESCAPGYRREIKFGGPFDRCVKCECHGHSTSCAPESGECICEHNTTGDTCE
RCSRGYYGNALQSTPDDCTKCPCPEDGPCVLHTDGDIICTDCPTGYTGRRCDVCADGFFG
NPDEGKSCVECSCSGNIDPNSIGNCDSLTGECKKCIYDTVGFNCEECKPGYWGDALLEPK
GDCKACNCFAPGTKRSNVDYVLLECRQSDGQCNCQPHVIGSHCDQCQPGYFNLTSGSGCQ
ECNCDVLGSVNSTCDVLTGQCLCKAGVMGRRCDQCEPQHYGFGIDGCQSCDCEVIGSESP
QCDVITGQCLCRDHIEGRRCDHCIENRYNLQAGCLPCDDCYTLTQSRVQTFRNDISVLEE
TLKEIIENPAPVDDVEFDNYVKAVTAEVEDLANVVNKKLAGDDSQIIEQVNMLRSDLKNA
LKLLSSVDDIINKANKKATMIDETLKQWDLVKDRARSDLENALYYLETEGKTQWELAQEA
SRKYGEQSQQLSEIAQEARKLAEQQENRSIEIEALAEKIANTSKRALVEAKEVIFGGDAT
SKEIAIMMERLNATEKLLNQTRKLAEEQLAEADRAYKAAAESLTVVEGLRLPNIDPQRIE
EEAKRVADDAKATADNAKEQAAANKELIDEAMRIIAEAKYELQRVQDQQKVSDELLADVD
AAKARAMEAVSLAENTLTEAQHTLEILNDFQERVDASKSEAIEELRNLKEIEKEIALAEE
TTREAENAIGNAKNDAQMAEKIALQAEKEAKSISKEAYELRNQTQDVRKTAEQLKSDANQ
LVSDVKETSTTMEDYRRQASSDKARASEAVQKAQLAEKAAEDANKTISEAQDSLRSIINQ
LNSLDGVNIEELDELEKQLDQAEELLNSADLDKQVSLLKEQKIEQDRTITQFRNEIDTLK
DEVQNLEEIRDSLPNKCFNVINLEQEGHK
Download sequence
Identical sequences J9FF58
WUBG_00827T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]