SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_00978T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_00978T0
Domain Number 1 Region: 220-343
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000395
Family Second domain of FERM 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_00978T0
Sequence length 615
Comment | WUBG_00978 | Wuchereria bancrofti hypothetical protein (616 aa)
Sequence
MIGLKGEKRGTKQRKLSESSHTDLRRSKSSSKSSDSSSSSGKKRVTLQNVEQDEASTDVS
ELKSIGKAQTLSHSSVDYTLSLNHLLDVNLRNCSQQSTPLSSKLDDSLDITIYWADERGL
KFSLIGGKFATASSLLLLLADHLGIVADIFKQVCALWMVSDLLEVQLKPHHNPYEIRKNW
MQFLQRFTNAESSELVADEPLLVLKRNVQLPVERERELEEDYTNEILTEILYRSAKQEVL
NGRYICDIDLNIKLAALQMAIDLEANEDVDILDVFGFRRDRDIFPLKYRHNVKTFHLFGI
PIIGCKGLETRILQEYRNIRLNFEGKHSCRKAYLNIIRNTPFYGQAAAFFRGYVERPSGR
PLKEIKRMILSVTLPDIPVLIGISCGYVTLIDEAKQEVLLVQRLHDCDCRYVDDHFEVAI
SAAVLTECPCFLLTFPDTSFLTDHNLNSESEMLKFSEKIKVLQVFSKQAIMIEALMNSLS
KLLERNTEQNTDSVIPNLKYDNCRQDLGGAVSDNSSPDDKNAYVTNVPVNGHDIQQNHSN
SLEIIGSQCSSSPTSSRLDEQTRGSSSSTSRSLTNVYNSPSPLISNIHKLCLATLDADGH
CVDAQGSLRVLLEVM
Download sequence
Identical sequences J9FL70
WUBG_00978T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]