SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_01648T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_01648T0
Domain Number 1 Region: 201-309
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 43-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-29
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 3 Region: 309-425
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-25
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 150-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000958
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 1-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000255
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_01648T0
Sequence length 453
Comment | WUBG_01648 | Wuchereria bancrofti hypothetical protein (454 aa)
Sequence
INECKSDSHGCEHRCVNKIGGYECKCNIGYSLRSDGKTCQSTCGGIIKASNGTFHSPNYP
LNYAPLKTCIWQIEANNEYQIIVNFTHFDVEGMKSACSYDYVLIQNYEGMEERYCGYYNS
LVYTSTTNRIKVLFVSDNTIEKNGFMAYFITDLNECRNNNAGCQQRCTNTIGSYQCECEN
GYVLADDGHNCKEGDCNLQVYDPEGEITSPNYPFNYPQGKNCNWHFVTTPGHRLSLSFEE
FMFEEHNTCKYDHIEIFDGGNSDATSLGIFCGSDIPLNLQSTANQLFMTMLTDASVNRRG
FKAFYSSICGGNLKAEQTIGFIYSHARYSDGKYEKKMRCEWRIVAESSRGVNIRFAQFDL
EREANCEFDYVEIYDGDEILEEYRVARYCGDKLPSSFTSTGRSLLLLLITDESEEQKGFI
VEYRSSIPGTITPFTSTTRRPPREPIINNNNNN
Download sequence
Identical sequences J9FJD1
WUBG_01648T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]