SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_02538T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_02538T0
Domain Number 1 Region: 607-694
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-19
Family Third domain of FERM 0.0084
Further Details:      
 
Domain Number 2 Region: 406-523
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000422
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 323-370,548-604
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000251
Family Second domain of FERM 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_02538T0
Sequence length 717
Comment | WUBG_02538 | Wuchereria bancrofti hypothetical protein (718 aa)
Sequence
MTHLVENDVTNDGSWQISILVTDLNIQRNLYVTGSLHIGGLMLRLVDEVDVSKDWSDHAL
WWPEKRRWLTHTRSTLDQIGITANCNLEFTPQHKLAIVQLPDLQMIDARLDFSVNIVRAT
QQLCREIGIRYSEELSLVRFIPPELLRKGLGFELDQAGPQQLPHLEESIGPGTLRRQKPI
SASTSNLSRPLRRGTSPGLSTSGQIFNASELGSLPRAGTVPRGVSPGPGAYGGSIGRNPI
MPSVSFCEGLENEQYDMALVQSPRIIPSKEMSVFRPQNYVEKAALNRGWLDSSRSLMEQG
ISEGDMVLLRFKYMSFFDINPKYDPVRINQLYEQAKWSILLEEFDHTEEEAMLFAALQLQ
ATLQRDLPEPEAPEKDDVDLLLDELEQNLDAAAFNRKADLTQVPELADYLKYMKPKKIAF
KGFKRAYFSFRDLHLSWHQNSNDMNGPPVGHFCLKGCEVTPDVFLAHSKFHIKLLIPSSE
GMSEMILKCDTEHQYARWMAACRLASRGKTMADASYQLEVDSIKKLLQMQLGVAGAQNST
LKKHLAVELPPDFNVDEFVSQRYARRARSRQALQQRIAEAHSSVRNLSSTEAKLQYIRAW
EALPEHGIHYFIVRFRNSRKSELMGIAFNRIMRMNIDTGESLKTWRFSTMKKWHVNWEIR
HLKIQFEDEDIEFKPLSADCKVAHEFIGGYIFLSLRNKEQNQTLNEELFHKLTGGWA
Download sequence
Identical sequences J9BGY5
WUBG_02538T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]