SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_02814T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_02814T0
Domain Number 1 Region: 55-97
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000397
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0071
Further Details:      
 
Domain Number 2 Region: 140-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000213
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000568
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0056
Further Details:      
 
Weak hits

Sequence:  WUBG_02814T0
Domain Number - Region: 113-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000441
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_02814T0
Sequence length 280
Comment | WUBG_02814 | Wuchereria bancrofti hypothetical protein (281 aa)
Sequence
MKWHWNEINQECEEFHYGGCLGNGNRFDSKQQYMNRCAYETHRHMLIREGYYNDDRKGHW
WYYFNATDGDCHRFFYYGCGGNDNRFYSHYHCKKVCGERLAPDTACDRCDVRTSICIIHS
KYNYACECREGFAKNAGGECVDLDECRIGNSLCNRNARCVNTVGSYTCKCNIGYSGDGKK
CAYVGIDDEDILTLFLRVIGTDQHLLLQILMSAYHGLGHATIMLSVIISKDRICASVDLA
MQVMATAALLILEIGVLVTTTIMKTVAADHFGMMGVRGNP
Download sequence
Identical sequences J9F9N2
WUBG_02814T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]