SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_04297T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_04297T0
Domain Number 1 Region: 7-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000583
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 48-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_04297T0
Sequence length 79
Comment | WUBG_04297 | Wuchereria bancrofti hypothetical protein (79 aa)
Sequence
MQKDTVISYCEKPSNNLCENGGTCINVGPNDYECVCLNGYSGKNCSRDEDDCIENSCAVG
STCIDGIAKYTCACPPGRI
Download sequence
Identical sequences J9BC77
WUBG_04297T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]