SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_04436T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_04436T0
Domain Number 1 Region: 401-614
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-25
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 2 Region: 3-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.008
Further Details:      
 
Domain Number 3 Region: 654-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 695-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 619-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 6 Region: 95-199
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000214
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_04436T0
Sequence length 1146
Comment | WUBG_04436 | Wuchereria bancrofti hypothetical protein (1147 aa)
Sequence
MTAVVQESVEPGHVILPISITDNDKEPNTGPYRLEIIGDSASLFAFDRNLNLITTKRLPP
HAKKEVYLLSVKVSDRDNLSTECPMTLFVKEESRHAPQSNPLKITLNTLMGEFLGGIVGK
IMATDEDSTDMLRYSLADREANANSIWSNHQHSKIPFSVDSETGDIIGEADLLAGTYRFN
VSVTDGKYIAMVPVVIDVISIDQDALDHSVSVRIHNLLGETFFNKHVTNFMHSLSRFLNV
KPQNVRILSVQSTLVRHHLLARQLNNRTTSEQDLDILFTVSRADSRGYHRPNFIRQRLED
NVAQLSDDIGREIISIITETCRRDICANGECRDRLYLDDAHSICYKTDHQSFSAPVHLRT
YDCTCRTGYAGKRCDIPVDKCSRDQCSKEEICVPMNTDIGFDCICPPGTTGDRCDATVCG
KDRRECSQDAEIGVGGDGFFQMTVANSVERRLELTIHFRTTSADAVIMYGAGNSDFHTIE
VERRYVQYRWNCGTGPGVVRINQQTVSDGKWHSLKVSRRSRHAKLVLDGLYEKEGDSPQG
SDVVNLYRQDIRLTFGAMVTQSVDDSTFIAASDLKPVVTKGMIGCFGRISVDGYEVPKTK
QSLYLYNTRLNCNTIVSAPCAASPCKNEGTCIPSSEKAYDCVCPPRYSGSNCEIDLTPCV
SRPCPRGVECINLHNDFYCSCPHGFTGKTCQLRGDWDPCLSNPCGHFGSCIRLPHSATFI
CNCSHGYSGTACKDRITDLIADGWPLNAIKIIGLIIVILLLIIFVTLIMCIYLRIKKSRK
SSKVREMEYETNNYNPRVSMSYEGVSHAVTPAPPLFPRLHSSNYEKGLPTVQVRPLPIHE
RISSSSIGGASRSPSLAGSNRCRIRWVAESGSIRNCGSERCIGSCDEIEPLASNEALRRY
GEVIMGDDDEMASCSSSQLQLSVADRRRRSSGPRYKAGMKRTRNIRVSNEAQTKEDWRKQ
CEKRINEACDAAAELRGERLKSSTGISRNITNDSSPNIKDDDDYMTMRPVHRRIITQSSE
SQRRPLLETSDSDGMESADFSYPDEVKPSQRREPPPPPAHNIRRKNKKAIASSGDVPNRV
YDEPAAIDVGNSDKKSSKIVKKTQSTSELVHSSERFEDFGNIDDSDDDRTVNTSTSSNVH
QTMAVL
Download sequence
Identical sequences J9ER43
WUBG_04436T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]