SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_06758T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_06758T0
Domain Number 1 Region: 399-418,997-1080
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000218
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 234-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 3 Region: 126-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 184-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 5 Region: 334-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 6 Region: 81-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family Laminin-type module 0.035
Further Details:      
 
Weak hits

Sequence:  WUBG_06758T0
Domain Number - Region: 287-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00024
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_06758T0
Sequence length 1081
Comment | WUBG_06758 | Wuchereria bancrofti hypothetical protein (1082 aa)
Sequence
MFSGWNNTVLDFWAREQPANPRIPFYENFMESTGEPTTRDTLMMVLHDLDELRIKACYYT
NCELASISELQLEIAKDDQTTSDSYTASSVEICQCPPPYTGLSCQQCSPGYYRVSNGRYL
GSCVSCNCNGHSGSCDPTTGICFDCEHDTFGDHCEFCRVGFYGDATKGGPYSCMPCACPY
ATDSNNFATSCQVSETGLLESCFCKEGYTSDHCERCSIGYYGQPTAIDGSCHKCNCNNNN
DLAIDGSCHPVTGDCYLCLNNTDGAHCEHCKPWFYGDAVEAKNCTNCACNQCGSSLCDNS
SGKCECLTNVEGEKCDRCVTNAWGFIRCHGCEMCNCALASSSPQCDAETGQCSCMPGAAG
QMCEICEYGYWNYGPTGCSKCDCEADLSMGTVCDVNTGQCHCQEGATGPRCDQCALHYVR
IPNFGCRLCDECVHSVMHDLDKLTDAVALVNGTVNNISTTALTGARLKRIHKKINDLKPI
VVNHMNSSSDVDIKSLSSNGILDSASNVVSVIVRANRSLDTLSTMGSTLNGIINRTNIFL
SGVFDRVELAASVVDSLKNLVFSLGKDSGAVYRQKWLTDSTLLLQKIRNAADDEETRERM
KDAEDETQKLLSRIRELKDEDNVMHAKYFTVRDQVDRLMNNITDYHSFLYRAANSVENTL
QRVNNSNIRHINSVQAGVKAGEAKIRETHAFINSLKETSEISIESLSNLNKTLREVISKV
QVVFGQLNIMNGTYRHRRTRNINKNEYRSKLKELESEALFLSSLFGRTRTEAKNAVAAAN
GYKELIEHLKKARDIANRTSLNAEQARRFHEEGVAASARTFREKSADLLRSAVDLKQSSV
NNVDVLKDIFLGKALELQFFIENQKRILDSLHPKFDDLEVNAKLEHSLTASEEARTRTDS
TISLFDRVKPDLEKMVSRSKKLVESISVSANNVDTAREQIWKLVNESSPIMEELKMRQHA
ALNTSTTIEHCREKLNLLKEKITLSRDLANRIKLGAHFEKGSILELPLPPRITRFAAYTD
IEFFFRTTNTSGLILFFGNELGVAGTRAVPTDDYIAVEVERGHLRIVINLGETPTQLVSD
S
Download sequence
Identical sequences J9EYQ5
WUBG_06758T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]